PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00092.1.g00240.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 627aa    MW: 68477.6 Da    PI: 9.8436
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00092.1.g00240.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.79.6e-122442791248
                                   HHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  12 lvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   l + v+++G + W+ +ar+++ gR +kqc++rw ++l
  Zpz_sc00092.1.g00240.1.am.mk 244 LREMVREHGDRKWAVVARYLP-GRIGKQCRERWTNHL 279
                                   7899*****************.************996 PP

2Myb_DNA-binding52.21.4e-16287327345
                                   SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
               Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                    WT+e+d+ l++a+k +G++ W+ Ia+ ++ gR+++++k++w+
  Zpz_sc00092.1.g00240.1.am.mk 287 LWTEEDDLALIEAHKVYGNR-WSMIAKFLP-GRSENSVKNHWN 327
                                   5*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.47225279IPR017930Myb domain
SMARTSM007171.1E-8229281IPR001005SANT/Myb domain
CDDcd001677.94E-11232279No hitNo description
Gene3DG3DSA:1.10.10.607.9E-19242284IPR009057Homeodomain-like
PfamPF002491.9E-10244279IPR001005SANT/Myb domain
SuperFamilySSF466894.49E-28259333IPR009057Homeodomain-like
PROSITE profilePS5129425.93280334IPR017930Myb domain
SMARTSM007179.8E-16284332IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-21285329IPR009057Homeodomain-like
PfamPF002492.5E-14287327IPR001005SANT/Myb domain
CDDcd001679.02E-14288327No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 627 aa     Download sequence    Send to blast
MEELFCTPVL TYGSLHVMQA LTRCYYMDRH GVCEPERWVR HRRHVSSAGQ RMGRLGKPRG  60
GMDTGRRMRM VADDLDGRRC PCSLYILRPP DRQCSISLAS CDRSSPPRPA SFLPPRLDDR  120
EPRMEAESSL RFVQDVSAAA AVHPGNVARA VPAAAGMLRP SMGALLAGFG MAPSGMFLPG  180
RXXXXTASVH RRRRRRGPGP RKRTSKLPLE LFPFLSRSVR ATSWLVSRRA GPWLTTDELL  240
IAVLREMVRE HGDRKWAVVA RYLPGRIGKQ CRERWTNHLR PDIKKSLWTE EDDLALIEAH  300
KVYGNRWSMI AKFLPGRSEN SVKNHWNATR RSLKAKRRLK KKRNAAQPTS PPGDDHCSVL  360
EEYIRGVYPA AAAADPAAPS PSVSPPSYNL AYGDAVSPLP AATAGGLFDP MAAAAAGMGI  420
MMYHNPGASG ISSSASPPSS NAGTAATDNV PPPLMLDLNA YYGEAPLHAM RKPPPPPAQM  480
MMMMFNHHNQ HQQQHQASSA YYTNLLSYPS FFDSFTWQPS SSVVHGSGSG GISNNNANNA  540
GGDHHQYYES EQAASGGGGR DDDADVVQMA SREFLTPSPD EMNLNLARGN AAGLTLSYGQ  600
EEEAGTAAEF VGLGSQQRGR ACMHGAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-382313298103B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1190195RRRRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001132209.13e-88uncharacterized protein LOC100193638
TrEMBLB4FFS13e-88B4FFS1_MAIZE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.11e-36myb domain protein 98